PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G0779
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MIKC_MADS
Protein Properties Length: 267aa    MW: 31256.9 Da    PI: 9.6873
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G0779genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.22.5e-2959109151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                  krien+snrqvt+skRrngi+KKA+E+ vLCda+v++iif+s+gk++ey+s
  Gh_D02G0779  59 KRIENSSNRQVTYSKRRNGIMKKAKEITVLCDAKVSLIIFASSGKMHEYCS 109
                  79***********************************************96 PP

2K-box80.53.9e-27121200180
        K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieel 80 
                  yqk+sgk+l++ak+e+l++e++++kke++++q e+Rhl+Ged++sL +keL+ Le++Le++l+ +R+k+  +++    ++
  Gh_D02G0779 121 YQKTSGKKLWDAKHENLSNEIDRIKKENDSMQIELRHLKGEDITSLPYKELMALEDALENGLTCVRAKQASIYTHTHTNT 200
                  899******************************************************************99988766554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.4E-4151110IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.53451111IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.29E-3652146IPR002100Transcription factor, MADS-box
CDDcd002652.55E-4152130No hitNo description
PROSITE patternPS00350053107IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-285373IPR002100Transcription factor, MADS-box
PfamPF003198.4E-2360107IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-287388IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-2888109IPR002100Transcription factor, MADS-box
PfamPF014862.3E-16132194IPR002487Transcription factor, K-box
PROSITE profilePS5129711.983134228IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MQISKPEIEC LKLLVFHSWL LSLNLILCSI PHHFTTKKHQ SKEVEREKSK MGRGKIEIKR  60
IENSSNRQVT YSKRRNGIMK KAKEITVLCD AKVSLIIFAS SGKMHEYCSP STKLIDILDQ  120
YQKTSGKKLW DAKHENLSNE IDRIKKENDS MQIELRHLKG EDITSLPYKE LMALEDALEN  180
GLTCVRAKQA SIYTHTHTNT YLHTHTHTHT HTHTYKILQN QQQLTYENVR EHMDHHGYHR  240
AARADFNSQM PFAFRVQPMQ PNLQERM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D2e-1652121168Myocyte-specific enhancer factor 2A
3mu6_C2e-1652121168Myocyte-specific enhancer factor 2A
3mu6_B2e-1652121168Myocyte-specific enhancer factor 2A
3mu6_A2e-1652121168Myocyte-specific enhancer factor 2A
1egw_D2e-1652121168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-1652121168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-1652121168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-1652121168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S3e-1651109159Myocyte-specific enhancer factor 2B
1tqe_R3e-1651109159Myocyte-specific enhancer factor 2B
1tqe_Q3e-1651109159Myocyte-specific enhancer factor 2B
1tqe_P3e-1651109159Myocyte-specific enhancer factor 2B
3p57_J3e-1652139180Myocyte-specific enhancer factor 2A
3p57_I3e-1652139180Myocyte-specific enhancer factor 2A
3p57_D3e-1652139180Myocyte-specific enhancer factor 2A
3p57_C3e-1652139180Myocyte-specific enhancer factor 2A
3p57_B3e-1652139180Myocyte-specific enhancer factor 2A
3p57_A3e-1652139180Myocyte-specific enhancer factor 2A
3kov_J3e-1652139180Myocyte-specific enhancer factor 2A
3kov_I3e-1652139180Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.237760.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ4098690.0FJ409869.1 Gossypium hirsutum MADS-12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012482533.11e-137PREDICTED: floral homeotic protein PMADS 2-like
SwissprotQ074741e-96MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLA0A0D2N9L71e-175A0A0D2N9L7_G
STRINGVIT_18s0001g01760.t011e-102(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.12e-80MIKC_MADS family protein